PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_15725A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 195aa    MW: 20564.3 Da    PI: 7.3426
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_15725AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.45.2e-161055147
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                               +g+W+ eEd ll ++v+q+G ++W++I++ +  gR++k+c++rw + 
  Oropetium_20150105_15725A 10 KGPWSIEEDALLTRLVEQHGAHRWSLISAAIT-GRSGKSCRLRWCNQ 55
                               79*****************************9.***********985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.396160IPR017930Myb domain
SuperFamilySSF466893.29E-16861IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-20859IPR009057Homeodomain-like
SMARTSM007176.8E-14958IPR001005SANT/Myb domain
PfamPF002491.7E-151055IPR001005SANT/Myb domain
CDDcd001671.63E-131254No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MKNSASVVKK GPWSIEEDAL LTRLVEQHGA HRWSLISAAI TGRSGKSCRL RWCNQLSPDV  60
QAAGSSCGSC SRSLGYGLIL SIYCPPVIPD ASANLVPNSN NSSAVHGATV DPPVSLSLSL  120
GLSPTTPNQA TKERVETSMG NSSPSPPSME GNEQLMAMIR QMVREEVQLQ TSQIANSLMA  180
ASARELEYPV LSGL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLK3Z8T96e-36K3Z8T9_SETIT; Uncharacterized protein
STRINGSi022959m2e-35(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3063944
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.13e-23myb domain protein 73